DPCstruct | MC15590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 254 ± 41 aa |
| Standard deviation of domain lengths | 41.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3XIP4 | 9-235 | YSSNEFFVLENKAIYFAKENEVLDCIKIIKYSNAREIYISWFGILLTGGSESTKPYNECFFGILDSKDSNLGLDESKPIYHLIGETD… |
| A0A7G2JVI1 | 196-421 | DIFAKDRSVLDIKDIEEKYQIDFKSLDIKIFLNSTLLTGSNELPNNPFYFGELDQDNTIKQDTPSYYFSPKDESSGKGRLSIFYKND… |
| T1CXE5 | 1-265 | None |
| A0A4V7IEX7 | 3-231 | None |
| A0A4V7IEH3 | 187-412 | None |
| A0A7M1CZ84 | 178-443 | None |
| A0A7S9NKE4 | 749-968 | None |
| A0A4U8T451 | 1-180 | None |
| Q7VJI4 | 2-197 | None |
| A0A809NK18 | 80-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.