DPCstruct | MC1559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10825 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6EC36 | 2-117 | QRVRSKAKWLIASVALYLGYRFAIGDLPIWMPKCLFHQWTGFHCPGCGGTRAVSALFEGNFVLAVRNNPLLILGTPLIGLAIYRQHR… |
| W7UVD1 | 2-131 | SKRLRIIIGAAAPLAAVILLCLRDHIIGLEKYFPECAFHNATGLWCTGCGNTRSVNDLFHGRILTAFRDNAAMPVIALLLILLYLET… |
| A0A368T0G0 | 2-111 | None |
| A0A1H9AXY0 | 11-141 | None |
| A0A371JHI3 | 1-137 | None |
| A0A498CHY3 | 4-139 | None |
| A0A1Y4IC15 | 1-120 | None |
| A0A1Q6JS48 | 2-131 | None |
| C9LEV0 | 30-175 | None |
| A0A6N8Z7B6 | 3-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.