DPCstruct | MC15589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3EIR9 | 17-90 | ASFETQKELSFIADNTDMESKSNLTATAGNQILHQVGDTSITAKGDCVIIKAGGVEVVIDSKGLVVKGGEVKAE |
| C3XI14 | 1-63 | MRYTKYVNVGGEYLTNVALSKDTKVGETTITISGDKIILKAGGVEVVIDSNGLVVKGGEVKAE |
| A0A7U7ZHT8 | 623-696 | None |
| A0A5Z1U577 | 58-117 | None |
| A0A4U8S239 | 12-74 | None |
| A0A0S4PUZ4 | 5-67 | None |
| A0A7S9X430 | 663-736 | None |
| A0A824XVW7 | 1-52 | None |
| A0A823PE14 | 120-193 | None |
| A0A825BK61 | 161-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.