DPCstruct | MC15588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 287 ± 28 aa |
| Standard deviation of domain lengths | 28.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2RFJ0 | 200-491 | LPTDSSTWRKSKVAKGETITKGNAVKQYRLDPKNDFKELQYVRRATKEGYFMMLYSTREVERVAWSKHGSPEGFDFYLSKLKTRHNR… |
| A0A166FG78 | 1-291 | MDQQNSTRVKKEEEEETKLPKSTDLSLVPINQKINKSAADKQYRLEKQDIYNAGLEVEIIPRKVVNRKDTQLYFEWEVEQLAWKIHG… |
| A0A2G8SMS2 | 149-467 | None |
| V2WWS4 | 51-292 | None |
| A0A0H2RLK8 | 42-340 | None |
| A0A4Y7T6P3 | 38-328 | None |
| A0A5C3PCM4 | 5-282 | None |
| A0A5C3P3Q0 | 30-353 | None |
| A0A2G8SMK1 | 286-582 | None |
| A0A4Y7T6N8 | 596-908 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.