DPCstruct | MC15586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 245 ± 45 aa |
| Standard deviation of domain lengths | 44.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166BM73 | 1-219 | MLQKRKAQKPEEPDNTQLVVYTPFGPRGRTIVHERDASNVLTWLGSVFGKDNILAIYAKKTDPNIIIEVPKELDVDDKLGAHPWSSF… |
| A0A0C2TN28 | 6-183 | IKDYDEKLLVVVNPWPPSGPTHRQFVNNVASWFEVMLGKSNGIKVEAVYQQRTHHHIIVELPAEADTDRLIGAHHWSDFLVEPWKSK… |
| A0A5N5QJH3 | 1-238 | None |
| A0A4S8LMH2 | 1-250 | None |
| A0A4S4LSB9 | 200-511 | None |
| A0A4Y9XVY1 | 1-310 | None |
| A0A4Y9ZYT1 | 1-181 | None |
| A0A0C3B9U6 | 3-158 | None |
| M5G782 | 1-203 | None |
| A0A4Y7TWF6 | 1-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.