DPCstruct | MC15585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 255 ± 34 aa |
| Standard deviation of domain lengths | 33.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A164M6Y2 | 172-433 | FDLAEYHCYDLLEKGKIDDVTRILSHLDRLQLIKSSIQHPHAIIYPSLVEFIVKDRKHEILRGINEFVKEVDQSRLVPLSLSEVFCI… |
| A0A165Z0C8 | 1-219 | MIISHSRAEVLRYLPEFFSSDHDWSNVDPDGASSALVIAAGYPPRFPPDLEHDLSPVIAHITSHPSSLHWRKASEASIAYLVQCDIS… |
| A0A164P0F8 | 453-710 | None |
| A0A164PQK3 | 1-321 | None |
| A0A164PDY4 | 920-1191 | None |
| A0A166GCE7 | 1-206 | None |
| A0A164PE29 | 652-951 | None |
| A0A165YMA0 | 68-278 | None |
| A0A165XJD5 | 164-423 | None |
| A0A165XGX9 | 178-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.