DPCstruct | MC15584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 163 ± 29 aa |
| Standard deviation of domain lengths | 28.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165Y1M8 | 1-145 | MSSLPPFLKQGDDGLIFITDFPAFLQSKYADPIGTSDVNRSWSSSSSTSNDFIRFAFPSRPDVGRLFVYNKQRSSQRICPSCHRLYR… |
| W4K1Q7 | 162-309 | HPMIHDPGNGPRVRDVRAFLASSFAHPPYTADPLCAEFAQPEVFQMLCTVLPEETALFLWYNKSRKTGRICPACRRLYCLGDALPDP… |
| A0A1Y2ISQ5 | 92-244 | None |
| X8JIA4 | 44-211 | None |
| A0A5C3L8I2 | 447-627 | None |
| A0A813V2Q8 | 2-133 | None |
| A0A0D2P8B2 | 1-151 | None |
| A0A5C3M0E1 | 126-294 | None |
| A0A165NIR1 | 3-140 | None |
| A0A4Y7SCM2 | 187-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.