DPCstruct | MC15583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077WFN7 | 36-148 | MMPPHDALLYDLHDTYVQPIPTSDQMIIPPPSSTTTTTTMIPRAGVSATNTSSSNNRKRPKRKQVKNACVNCQKACKKCDDGRPCQR… |
| A0A165X6H3 | 1-128 | MMDASPAGGSWATSSSHHAQDHSHAQSQAFGPSQNNSNQSASSQVQRTFSNDGGQVSSGGGGGDDDDNAGGKKKKGNKRRKVNHACL… |
| A0A2U3EPS5 | 1-115 | None |
| A0A5B0QM63 | 15-147 | None |
| A0A077X0N0 | 5-118 | None |
| A0A4S4LC02 | 76-210 | None |
| A0A168JLK8 | 1-121 | None |
| A0A0H2RNM4 | 3-150 | None |
| A0A4Y7QJB0 | 11-149 | None |
| A0A1Y2CQ64 | 108-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.