DPCstruct | MC15582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 209 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165WTY5 | 69-244 | LQRKIIEFHLMDQKSLTLAAVLPDNKTYVSGSDSPIIHAVIGFPASNGGSMAVLDLASLQFGDVGRGFKGRGIFVLETVEDYLSRLN… |
| M2RTB1 | 90-293 | HPDGVKTPTSNALTRRELEDVFWRCKDFDSGYILAYAAQQVFNTLPPTAKLRARTSTGHTITCAPSAVAVAEIDILPREACLMVVYE… |
| A0A2T3BAX3 | 1-192 | None |
| S8EGA8 | 4-208 | None |
| A0A4Z1H375 | 192-406 | None |
| A0A4Z1IL45 | 303-503 | None |
| A0A286UBY0 | 214-441 | None |
| A0A6G1JQZ8 | 106-303 | None |
| A0A4Z1JFM9 | 137-335 | None |
| A0A0W0FA06 | 63-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.