DPCstruct | MC15580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 468 ± 103 aa |
| Standard deviation of domain lengths | 102.53 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3D2E7 | 28-363 | TVDSIRPFNGKLGTLVEEGWFMVTPNVLGLYHPPLGVNREMYMRADFRYSADDPLLWPQFYVRSNSWLSCIRKCPNDPLDPLQPLYD… |
| A0A165WQB5 | 30-503 | WISTPNMPFVPEPYAITREVRLRADGRSGFDDYTCWPQRYYTQTPHLTCIPRSPMKFSFHVPTEYASCINLIFSDPSLPGSLPSKIR… |
| A0A4Y9XLX5 | 3-578 | None |
| A0A4Y9Y5G7 | 316-859 | None |
| A0A6A4GWQ5 | 75-522 | None |
| A0A6A4GJY7 | 1-445 | None |
| A0A836DBX3 | 60-548 | None |
| A0A284QSB4 | 26-560 | None |
| A0A2H3CYI1 | 12-363 | None |
| A0A2H3DA42 | 140-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.