DPCstruct | MC1558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6DXY9 | 3-125 | KNKISFHTLSSVLLPLSVCGTLFIFSSSSSAQIVIPTTPSIEIDRYASLEDQLINRLHAVTEQQQAYIRFVVRQVKEGKLEIKLVVA… |
| A0A5C5WG47 | 1-116 | MMMFRIWLSLGLLIVCVGQCHAQITASQVSSGTGSRSATLEEQLVNRLRASAEDQRNYLKYVVKQVELGKIDVKLVVGIERYALRRN… |
| A0A3L7STY8 | 1-107 | None |
| A0A3L7NAK8 | 23-120 | None |
| A0A3E0PQW6 | 2-141 | None |
| A0A517SYW2 | 1-164 | None |
| A0A142XZC5 | 1-121 | None |
| A0A5B1CGT7 | 32-170 | None |
| A0A2E2AQS6 | 40-159 | None |
| A0A5C6BX12 | 8-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.