DPCstruct | MC15579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3FJU8 | 8-87 | YDLGDTPLVVITGGKKKKPEGDENWSGKALRHHSRQLQKDFLKLSTNSQQVIAKKSGHSIHLDQPELIASVIKNMLMELA |
| A0A6I3MPQ9 | 10-76 | VPVIAITSMKIDAEHDSDDRQLWYDSNESLKAGVKDFTHIKTTKSGHFIQIDEPKLVLGNIRLLLSK |
| A0A5R9F4K1 | 2-84 | None |
| A0A073KJF9 | 3-78 | None |
| A0A433UUU9 | 17-99 | None |
| A0A4R7RHI4 | 53-147 | None |
| A0A2V7L1U2 | 12-88 | None |
| A0A2B6F3D9 | 48-131 | None |
| C3G3B5 | 3-68 | None |
| A0A1Z1WQ45 | 19-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.