DPCstruct | MC15578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447S9C8 | 237-308 | YDNKGLPIRAYQPYFLDNWRYISDDSARQDTYADTHIYDPLGREIEVITAKGYLRRAHYFPWFVISEDENDT |
| A0A4V2BHD6 | 1-80 | MIRLYRPYFANSDRYVDDASHRDAEHSYHDLQCYDALGRPTQTWTAAGWLRRQRHNPWYSISEDENDTAEEVLAMRAAEA |
| A0A0T9PL91 | 371-442 | None |
| A0A3S9JPU0 | 293-365 | None |
| A0A191YZJ4 | 432-513 | None |
| B6A880 | 1410-1481 | None |
| A0A2U0WEZ0 | 45-109 | None |
| A0A1M7GL31 | 228-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.