DPCstruct | MC15577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2B6E2 | 13-201 | PQMVLWMREFSEMAILDFILSQQDRIENVDYKWFWLYNDNGEALTKSEGSELPRTRMSKIAAPTELASKTPMLLQRTMISDNDAGGL… |
| A0A2N6CPG2 | 350-521 | AQVAFWMQELTEVVWLDYLFNQQDRIGNVDYQFLWHWWQDGQFMTRLAAEPSVPADIAAYAPLRLKRSRINDNDAGGRSAYVNYAEK… |
| A0A2V5QTJ3 | 60-239 | None |
| A0A2V5RQG9 | 243-418 | None |
| A0A2V5R4R9 | 177-356 | None |
| A0A521FYB5 | 25-222 | None |
| Q6MKA0 | 317-532 | None |
| A0A2V5V3S4 | 9-184 | None |
| A0A1Q7Y2Q0 | 103-275 | None |
| A0A2V9S8M7 | 730-902 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.