DPCstruct | MC15576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 130 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | CL0040- CL0298 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812YTP3 | 119-256 | RASALKGELLAQIDSAGDLRALEEVRVAVLGKKGRVTELMKGLGGLSPDARREAGQRLNALKDALAEAIEARKAALAEAELEARLAA… |
| A0A4V2AX88 | 8-152 | LKQIEEIKGQFQADSASSKAQLSIKVVEDLRIKYLGKKGLVTGLMESLKSLSKEVKPQAGKVINELRQAVEAGLGSLKEEAESSALD… |
| A0A2G1C3L5 | 1-136 | None |
| X1IAN5 | 2-136 | None |
| A0A2H0X9H6 | 5-129 | None |
| S7U3C1 | 22-160 | None |
| A0A5S9MIH5 | 3-110 | None |
| A0A401FKF8 | 3-122 | None |
| S0F3V4 | 150-283 | None |
| A0A2V8ZWZ7 | 18-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.