DPCstruct | MC15572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 340 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 73.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8AWX5 | 85-433 | TLLVYKMNTLAFECPNKHKIVKGGNFCFIQIPCMCSLSADYLYIPKKIKKCTNYKDTVTVLHPINLALIQHFFDSDTYSSILGDTTF… |
| A0A6J8D470 | 1-328 | MLFLPKKVDQCQNNSDSVTILHPVNLALIKSFFSSETYNSIMGVTTFTNPAVLNLPNLNFYNHSFSQFIAQDQQLHFSLKRIAQATK… |
| A0A6J8EC10 | 349-698 | None |
| A0A6J8E7G9 | 242-565 | None |
| A0A1S3I8Z8 | 1-346 | None |
| A0A6J8D2F4 | 201-550 | None |
| A0A6J8CWH3 | 144-468 | None |
| A0A1S3JJ33 | 698-1044 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.