DPCstruct | MC1557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399RID0 | 2-69 | LTATIWRNQSQDGNAFYNVRIVRSYLKEDTWREASSFSGSELLRLSRLSQAAYDAIARHRKAERQAQK |
| A0A5C6DRX2 | 2-91 | EKKDNKPVKEFRLGAVRASVWINRKESGENWFTVSTSRGYKDRDGDWSDSKSFRPHDIPVLGNVLELAQTWIREHRDALENEAAPVH… |
| A0A7C3KSN7 | 4-97 | None |
| A0A1P8WP99 | 2-81 | None |
| A0A1G1AKC2 | 3-65 | None |
| A0A1E4HY67 | 1-69 | None |
| A0A5C6DGD2 | 1-74 | None |
| A0A1M6UNN4 | 9-95 | None |
| A0A497I8K6 | 15-98 | None |
| A0A7T9JT14 | 23-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.