DPCstruct | MC15569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 253 ± 53 aa |
| Standard deviation of domain lengths | 53.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.21 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0168- PF11560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8CYH1 | 52-303 | NFTKLRKRTRRTVSVSRPQTEPKETSPYSDVSSEDDSESSNSDIELDEQEQPKSSQSHSSTHTSNTKNDTMSVIEDMKGFMVTEEKA… |
| A0A6P7H7I0 | 5-156 | GEDPLKTNLNASEMLPDVAKRLNYSLSKGLDKSIVGKLTEIFLTATNCERLCPPQLNSEIFSAINDKNKIREDKYLQTMQTILAASI… |
| A0A6S7FTT9 | 28-258 | None |
| A0A6S7FXM7 | 31-250 | None |
| A0A6P8HDU0 | 58-316 | None |
| A0A7M5V165 | 1-274 | None |
| A0A2I4D7M4 | 1-387 | None |
| A0A6A4JVM0 | 1-198 | None |
| A0A835GN80 | 143-484 | None |
| A0A0B7N6C8 | 4-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.