DPCstruct | MC15566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 176 ± 25 aa |
| Standard deviation of domain lengths | 24.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813ZE42 | 1-123 | MVLLDKVKTMYKSLTENDNQRTPITLQNFNIVQNISEQSTVTLSKGWALSLPKTKTRFTDKQKKYLVDAYNDGEETRFKSKPETLSL… |
| A0A6J8CK42 | 17-181 | VQKMAVSNHLAQMRHWITTYCRKTNYKQVISVHDKAKIMYGTKVNSLFINTQSVSIPSDSMAGESGLRQGWALKTKKKRVIFSEAQR… |
| A0A6S7HMS0 | 1-179 | None |
| A0A821J9B5 | 27-246 | None |
| A0A815H0J1 | 1-147 | None |
| A0A820T043 | 258-444 | None |
| C3ZUL4 | 4-154 | None |
| A0A6S7GNU4 | 75-269 | None |
| A0A6S7GCM6 | 183-353 | None |
| A0A6S7FV16 | 192-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.