DPCstruct | MC15563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4Q600 | 9-83 | DARHHLSDDELVHLRSQVIALEQTMIAMMAGGSDDQRALIHDMAAFVRPPMDAVQDPLMMHAGDLMDHMADRATL |
| A5PD71 | 3-80 | GDVPVLSDAEMIQLRIRVIALENIVLSLLSEADDAQLERVAEMADLITPRPDATQHPLTIHAATQMRQLVERANHFRS |
| A0A6G8C5U0 | 39-118 | None |
| A0A839Z7S0 | 9-84 | None |
| A0A1B6Z720 | 24-112 | None |
| A0A1A7QJZ6 | 27-99 | None |
| A0A0L6T888 | 12-107 | None |
| A0A6N9RIR0 | 93-172 | None |
| A0A4R3USC1 | 50-134 | None |
| A0A8B6LWZ6 | 45-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.