DPCstruct | MC15562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7SP60 | 3-80 | ISAGVVHDLPDDLKSVLKSDADMLAAWEDITPLARNEWICWILDAKKGDTRARRIERTQHDLLNGKRRPCCWPGCKHR |
| A0A0Q4Q0E8 | 2-82 | KSGTVHIVPDDLATALTADASIEPLWDALTPLGRNEFLCWIKDAKQPATRQRRIARTIAELVDGKKRPCCWPGCIHRTDKA |
| A0A848SWH8 | 14-86 | None |
| A0A7T9K177 | 1-94 | None |
| A0A7T9ITK9 | 5-88 | None |
| A0A2H1QGW9 | 9-92 | None |
| A0A7I9XF16 | 104-188 | None |
| A0A0L0LKB2 | 1-64 | None |
| A0A136LA81 | 37-114 | None |
| A0A829Q5G5 | 2-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.