DPCstruct | MC15561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 1 aa |
| Standard deviation of domain lengths | 1.43 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5AR49 | 14-118 | GEIERRLRTCVRRMCGTVEELRKASGNNRANSVDDLTVWQIQQVFAKPDRWACLMWQLPQDNFVAKLDAVRKIRNEVAHFRPDPLTG… |
| A0A6B3BBM4 | 2-104 | GEIERRLRRCLGRVYGEADVQKVHKKKISVDEMMFGEYIRLLDNEERWDKLGWPLVDRSHFIGLLGRVKDVRNTVMHFNAPSLKAEQ… |
| A0A2W6E4Q5 | 62-166 | None |
| A0A3E0GVN7 | 322-425 | None |
| A0A538NVT8 | 543-649 | None |
| A0A5D0U991 | 555-661 | None |
| A0A328NDX1 | 599-703 | None |
| A0A7X6LA13 | 273-379 | None |
| A0A6B1QJ91 | 381-487 | None |
| A0A1S1Q4E9 | 327-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.