DPCstruct | MC15560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 128 ± 22 aa |
| Standard deviation of domain lengths | 21.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9M6A4 | 109-231 | QNALHYIGIAADEAHRCKDDPQNRYPLVEWKITEAQALQICYSRGFDFGGLYEIYRRASCWCCPLQRIDELRKLRTHHPELWARLRD… |
| A0A6B3AZ82 | 2-124 | EKAQWVGISTDEFHRAKDADVKYMRNRHPLIDMGWSRTDCIRYLSQLGLADTPKSSCLGCPFHGNAQWRHIRDTSPEEWADVVEFDA… |
| A0A426U253 | 16-161 | None |
| A0A6N8WB21 | 148-292 | None |
| F4XBZ1 | 1-120 | None |
| A0A4U8UFG2 | 48-166 | None |
| A0A7V5LZ07 | 75-188 | None |
| A0A1Q6KN38 | 16-134 | None |
| A0A0F9N5B2 | 255-406 | None |
| A0A0F9NWI8 | 85-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.