DPCstruct | MC15558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7WXH2 | 40-124 | LELPMDDMDLTSAESKATYKQIQNYVLEKYGFKVSNLYIAQVKEKYGIKERENYNKRKNNDSKQPICPIEKEEAIKDAFRYFQMI |
| A0A7U9SI98 | 84-166 | LDLDEMDLTAAEKKATYEEIKAYVKEYTGLKVSNLYIAQVKQKCGIIERENYNKPKSEGTRQPQCPLEKEAAIKAALEHFGMI |
| A0A415P8S4 | 396-480 | None |
| R5HRE3 | 2-75 | None |
| A0A133ZYK7 | 118-202 | None |
| A0A1C6DYS3 | 1-114 | None |
| A0A3C0P282 | 273-352 | None |
| A0A8A8TPF4 | 16-95 | None |
| A0A095YX97 | 292-379 | None |
| A0A416LG19 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.