DPCstruct | MC15557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A807PKH6 | 1-100 | MSQNTKGKLSLVGFSLMIFTTVFGFGNIPVAFYQMGYGAIPWYIIGALLFFLPFAFMVTEMGSAFKDEKGGIYSWMSEAVNPTFAFI… |
| A0A7U9SI35 | 1-96 | MDNSKKMTWYTLAFIAFSGVWGFGNVANGFMYFNGIQVIFSWILMFVLYFVPYSLMVGELGSAFKTSGGGVSSWINNTMGPKLAYYA… |
| U6F2Q0 | 1-96 | None |
| A0A0R2I031 | 1-99 | None |
| T0EG31 | 1-82 | None |
| E2YSK0 | 2-100 | None |
| A0A4R2K0L0 | 22-119 | None |
| A0A447UQ63 | 32-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.