DPCstruct | MC15555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0D753 | 2-55 | FAKHSWYFRNALVRANYRNIQKGIDYSPIYQVRFFRNLLLKDGWVLKNRYLHIR |
| A0A7U9SDM4 | 6-71 | YLRTLGFSAANDIFADNAWYFRNALVRANYTNLQKNIHETTEYLEAFLRNLLLNENNELHNRNLHI |
| A0A7V6W2G4 | 4-82 | None |
| W5IK37 | 9-86 | None |
| A0A1M6TEX2 | 3-70 | None |
| A0A7X9AB00 | 123-195 | None |
| A0A412E0I8 | 42-122 | None |
| A0A1X1Q4F7 | 17-82 | None |
| R6A9B4 | 26-107 | None |
| A0A3S7MZT6 | 3-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.