DPCstruct | MC15552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7Z8Y0 | 1-103 | MRACMRHIVFVLLFSLSWLAQAVEFDEHTRYLTLGPQMQVFEDVRGDATIEQVSSAALSGSFRTNGKAVLNAGYSRSVFWLRVDLLY… |
| A0A2W4T5N0 | 12-98 | IILLLALGTSSVCASTIVLQDNRSYTLAGHLEILVDPSGQLTFAEILSPRLNNEFKPIHGDLKRGYSADSVWVRFELRRLMPFPKDS |
| A0A6J4YAM2 | 20-143 | None |
| A0A3L8BWB7 | 11-104 | None |
| A0A2N1RVY8 | 12-111 | None |
| A0A6M5XWI9 | 12-83 | None |
| A0A2D9DQZ8 | 1-101 | None |
| A0A2M8HL68 | 1-93 | None |
| A0A1G7VB00 | 2-99 | None |
| A0A3T1DJY6 | 4-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.