DPCstruct | MC15551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 408 ± 40 aa |
| Standard deviation of domain lengths | 40.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7HVB7 | 75-430 | KIRLERLRPQVASAMRLLSFAAANGKKVDDKVRTSLTAIANALEGGTATAAHEDEFLKSYEELCLQTAPVTAESLAASDTRLPDLSN… |
| A0A2W4SJH7 | 1-451 | MLKLFNWISRPLAPDAISDDGHANDNQGAWQLPIADAVREAGALLAFASRSGKTVAPEHVKSILEMRRLINDSSNAPAIDTDREQAF… |
| A0A5R9Q3K7 | 5-356 | None |
| A0A7Z2G917 | 83-510 | None |
| A0A450TJF5 | 12-389 | None |
| A0A101KQ56 | 5-393 | None |
| A0A2W4QSS9 | 2-389 | None |
| A0A0Q7SWI6 | 4-484 | None |
| A0A1H0DMG2 | 55-481 | None |
| A0A4R1W1L4 | 1-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.