DPCstruct | MC15548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4RK48 | 6-163 | FSRQEEPQGSSDRGFGLVFCGFFLILAVLNYFAKLPFRIDPAYLTACPFWSAHPELKGHALTLTFAIVSGVFLLLALIVPKALAPLN… |
| A0A3M0ZC20 | 9-128 | NPGRRELRQFAGLWLAVFGALGGWKLYASAAAAGWPWLGAAVAVGLPGLVWPALVRPLYVAWMALAFPIGWTVSHLLLALIYYGVVT… |
| T1DVK4 | 3-143 | None |
| A0A356VB74 | 53-171 | None |
| A0A3D8INW5 | 1-149 | None |
| A0A7C4QLH7 | 2-148 | None |
| A0A2M7WIF2 | 14-136 | None |
| A0A7X9FGV2 | 1-131 | None |
| A0A348MZA9 | 25-153 | None |
| A0A2T5JAL6 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.