DPCstruct | MC15547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 363 ± 66 aa |
| Standard deviation of domain lengths | 65.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828M1I9 | 3-292 | EVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVH… |
| A0A2W4REH9 | 1-354 | MVFDIFSIGDSAFLAAVLNAVAMIAGTGHYATAAGVGALLGILMTLVRGLTQYDGRGIRYQDMLVSILIYLLMFAPGVRVMVEDAYT… |
| A0A7R9N8Q3 | 20-397 | None |
| A0A520XFP7 | 2-401 | None |
| A0A2Z6IE50 | 3-423 | None |
| A0A522DQR0 | 1-348 | None |
| A0A7W6A1C4 | 2-417 | None |
| A0A484VJT3 | 2-315 | None |
| A0A2R8F0I4 | 3-423 | None |
| A0A0U5JJK9 | 1-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.