DPCstruct | MC15543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 190 ± 21 aa |
| Standard deviation of domain lengths | 20.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 13.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415M7D3 | 11-195 | VVEPDEAKHEGVVKIYRDNATIKLDYEKNQDFINIVKNAGYKWDGTNWGMKIINSKIQGEFKDRRIEIGNILLNNGFAVEFEKLEEA… |
| A0A246BTE7 | 48-263 | VLRPASPVTVEVASVWPTQDGRGLRARLREKNEAFRAVVRAAGFEWNEREFCWTRTLNVLEGPAQHRVAELGADLLRAGFIVSVSSA… |
| A0A7R9UJF0 | 57-279 | None |
| A0A4R5VEQ0 | 6-185 | None |
| A0A834AKA4 | 125-298 | None |
| A0A7S0ABS7 | 11-192 | None |
| A0A4V1FD94 | 6-187 | None |
| A0A0Q4P3X3 | 93-294 | None |
| I4AL62 | 2-185 | None |
| A0A6C0GEI3 | 2-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.