DPCstruct | MC15542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 9.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A246BIN2 | 136-235 | LRLVNNVGDADINLLLRQWTQAEAYEPTTITRNSDGLVTTATVTWPDGSTGTLTATNYNATHSVYDGFTVTHASGKTVTQAAVTRDS… |
| A0A7X5U5N4 | 125-229 | ATVTNALAGKAAAAAVLLSLAANPDQLATGTITRSATSAATGFSVSWPDGATGTFTGTESTSFPGAIDSYVVTHVLSAVTTTYTQPA… |
| A0A2Z3JER6 | 167-279 | None |
| A0A7Y9DWQ5 | 275-408 | None |
| A0A6P1NP24 | 28-138 | None |
| A0A2G6EX80 | 31-144 | None |
| A0A4V1V1Y1 | 316-428 | None |
| A0A1S2I7U6 | 62-163 | None |
| A0A4Q3PKF0 | 121-224 | None |
| A0A4Y6QYY0 | 7-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.