DPCstruct | MC15540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 686 |
|---|---|
| Mean domain length (aa) | 192 ± 39 aa |
| Standard deviation of domain lengths | 39.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.00 |
| Pfam Score | 99.45 |
| Assigned Pfam label(s) | PF14449- CL0172- CL0263- PF07833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9B0R6 | 33-267 | LHLTLGNPSNAVADPLVPNNYLIERTQYALAYQRDAGIPAWVSWHLEVQDLGSTSRGDFAVDTSLPSGWYRVATSDYSGSGYDRGHM… |
| A0A495J575 | 15-212 | YCYSQGAATDTVTINQGNFKVTWSHSAKYPVKVVWKLTKEMLSCSQPLKRCNCFQADPQLAQESNLTADYAHSGYDQGHNFNAADDA… |
| A0A2I4CTM6 | 45-286 | None |
| A0A2N5YL01 | 13-220 | None |
| R6XXC2 | 38-280 | None |
| A0A139Q8Y6 | 16-194 | None |
| A0A1X7AQP3 | 178-339 | None |
| A0A7R9A2Z9 | 362-581 | None |
| K3WR66 | 3-139 | None |
| A0A6A4JJ76 | 25-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.