DPCstruct | MC1554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4LV80 | 19-106 | SMQDYNNTVQLLAQKPEYLKTLQLAVQKEEDNLSNKQYLGWQWFDVETHPAKLMKLITSSIVKVNFKSNSSTNYLLKNRESVKRAIKR |
| A0A1Q8B8E4 | 3-81 | QFLARFPDYRKALWLAARSEEEGLGNPSYQGWQWSDVEMHPTRVLKLVIEGIAKIGMRTRRATYYLLKEPDLVKTVLKS |
| X1TLQ4 | 4-99 | None |
| A0A1Q7SPX0 | 4-93 | None |
| A0A5A7RQ63 | 7-95 | None |
| A0A0F9C2J5 | 7-85 | None |
| A0A7C3AZT2 | 29-123 | None |
| A0A1Q7ZL90 | 44-133 | None |
| X1G844 | 9-99 | None |
| A0A1Q7MMG7 | 30-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.