DPCstruct | MC15539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 371 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | CL0169- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328YZ12 | 16-97 | SFRRGLLPIPSEYYQGQGLKLTGGGEWRNAICPFHDDTRPSLRVHLGSGAFRCWACGKRGGDVLDFHRQRYELGFREAAIQL |
| A0A495IYY4 | 5-93 | EFIASVQSKTDLVELVSEFSELTLVGKQFVGPCPLHGGTGDTFTVSIEKQIYKCFKCGQGGNAIRFMVAYKKLSFPDAVIFLAKRLK… |
| A0A1Y4H785 | 2-86 | None |
| A0A354CZK4 | 31-132 | None |
| A0A517TSI9 | 37-136 | None |
| A0A848A0X0 | 7-97 | None |
| A0A0R1ZX12 | 201-288 | None |
| A0A356Z4D5 | 13-110 | None |
| A0A0F9N9U3 | 14-122 | None |
| A0A809NDF9 | 3-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.