DPCstruct | MC15538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 166 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821LWQ3 | 1-157 | MWQVYTRRRRIRWLAIGFVIILIVWCFILYKSLYINYEQDTSHTHASSLTSVSSFLYKINNVDLFIKQTPVKYNYHVFYYPWYGNPE… |
| A0A452HYN6 | 1-156 | MARLRRRACIALFLFTLFIFGTMMGLRTLKPSDGFSDLAPIAERGERRSVSHEAISRPQAATSSDAKAPTPPVYYDLHIFYYMWYGN… |
| A0A183AY44 | 1-154 | None |
| A0A817R380 | 2-157 | None |
| A0A6I8PEK4 | 274-456 | None |
| A0A3B5KZM3 | 1-120 | None |
| A0A1S0TN68 | 5-177 | None |
| A0A6I9N6Q3 | 3-180 | None |
| A0A6J0VJP7 | 2-188 | None |
| A0A6J8BDS9 | 6-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.