DPCstruct | MC15536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0J9N1 | 2-82 | ILTQIEAKEACTWLRAAGFPQYAQLYEDAQFPIDISSVTRDHDFLDRDAIEALCRRLNTLNKCALMRLEISPQRKRSEDSD |
| A0A452HRR8 | 48-134 | HQLLTKIQQEIEAKEACDWLRAAGFPQYAQLYEDSQFPIDIGAVKKDHDFLDKDLVEPLCRRLNTLNKCASMKLDVNFQRKKAITLA |
| S4RZA0 | 5-84 | None |
| S4RVC0 | 2-89 | None |
| A0A803YGD6 | 39-120 | None |
| A0A5S6PLT1 | 1192-1285 | None |
| A0A4Z2AY65 | 4-80 | None |
| A0A3B5KSX3 | 39-123 | None |
| A0A0R3Q7A8 | 1-68 | None |
| A0A663FGU0 | 19-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.