DPCstruct | MC15534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 361 ± 32 aa |
| Standard deviation of domain lengths | 32.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 31.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8F1M3 | 1-325 | MKDFQRELEDSRASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASTVSGRNTLQDEKRRLEARIAQ… |
| A0A452HNM5 | 2-333 | KELWREVEESRTSREEIFIQSRENEKKLKNLEAELLQLQEELAAAERAKRQAQQERDDLADELANGVSGKSALLDEKRHLEARIGQL… |
| A0A820QQM8 | 64-432 | None |
| F6QBA2 | 449-769 | None |
| A0A5N5Q4L3 | 18-393 | None |
| W5MLK3 | 115-487 | None |
| A0A1W0X882 | 446-870 | None |
| A0A674K009 | 61-369 | None |
| A0A6A4WTV7 | 3-338 | None |
| A0A7J8AII2 | 3-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.