DPCstruct | MC15531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 117 ± 35 aa |
| Standard deviation of domain lengths | 34.80 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 76.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1G4W9 | 1-75 | MKSVTRRHREFIPDHKKDKEYWMKRQKNNAAAKKSREKRRLNDVVLTNQIVQLTNENKRLKVELQAIKQRFGLSI |
| A0A452HHQ3 | 1-97 | IPQHPQPSRVAAASLPARDTGARALQSARQGVMQRARFISDEKKDASYWEKRRKNNEAAKRSREKRRFNDLVLESRVLALNEENLRL… |
| A0A3B3X940 | 1-140 | None |
| A0A553NAA3 | 20-132 | None |
| A0A183TDT4 | 82-174 | None |
| S4RGV3 | 5-92 | None |
| A0A667IJR7 | 16-122 | None |
| A0A4W4FMU7 | 1-93 | None |
| A0A814P877 | 62-166 | None |
| A0A673WHG0 | 24-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.