DPCstruct | MC1553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M6W3L6 | 1-164 | MGKQINFYMHPEDLKKFDSVLKQEIDLKIFYTTSKENGLDFLDDVVIKKYGEERITVMLTKDLYLKNIKLNRIKENQWSVDSIFSPV… |
| A0A1Q8B1G9 | 5-171 | SASGRQVNFYMTNEDERQFVDFLMTTGDVVLHAYTSMTPRFEPVRLLPEPYSGDFWYAFTILNRSISSNLRVRFISQQGYYVVDELN… |
| A0A3M0GDB8 | 3-150 | None |
| A0A537GW58 | 1-173 | None |
| A0A848FQI5 | 130-300 | None |
| A0A6C2YQX2 | 26-200 | None |
| A0A2N6IHT8 | 107-266 | None |
| A0A838QAR5 | 19-199 | None |
| A4YTD0 | 53-219 | None |
| A0A2V7STC5 | 396-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.