DPCstruct | MC15528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 164 ± 38 aa |
| Standard deviation of domain lengths | 37.63 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 81.92 |
| Assigned Pfam label(s) | PF20659- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1AKM0 | 26-177 | PDLVPVAREVFERLMKGDNQISFIPSGDPVTRDDLLEIHEGTRTEEGLRTNIRVGVQYIEAWLRGNGAVPLYNLMEDAATAEISRTQ… |
| A0A2X3K8A5 | 38-192 | AHPGLADTAMAVFNDILGSRKNQLEVMREQDVPITADQLLAPCDGERTEEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEI… |
| A0A258VX60 | 7-131 | None |
| A0A0N4VZG8 | 6-165 | None |
| A0A2W2B118 | 296-450 | None |
| A0A0K2RIY7 | 2-97 | None |
| A0A7J6Q8E2 | 959-1178 | None |
| A0A2V8XIK4 | 18-168 | None |
| A0A1Q7KFR2 | 46-189 | None |
| A0A815KYY8 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.