DPCstruct | MC15524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2J7P8 | 3-116 | TELEPAGCYDELVDMLDDVRCARGLSFEQLDELSGLASDHAQKCLGPARAKKLTPMLIDTLLPALGVRLAVVDDPAAIASIEQRWGQ… |
| A0A6N7GW47 | 4-101 | PLAEIHEYLDLHQVMRARAEYLQISRTTIDTIAGVPDGYSGKLLAPSPLKCAGHKNLMPLLGALALKLVVVEDEEALAKIKRRLEPA… |
| A0A0R3MXH7 | 1-118 | None |
| A0A5C1ASR1 | 1-120 | None |
| A0A1M5QTP7 | 79-184 | None |
| A0A7W6T107 | 1-96 | None |
| A0A2T7U578 | 2-143 | None |
| A0A2M8RFM6 | 5-120 | None |
| A0A5S4YL35 | 2-108 | None |
| A0A4Y9P4I3 | 3-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.