DPCstruct | MC15523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496W5Y4 | 14-138 | YEPSEDQLRRITDYVIERFSIFLKQEVKIYNTSIDSGRSATYFIYSGSQIASIFEIEWEGVLTVQLVDGKPYLDAQLLLFSRQYRLG… |
| A0A7W3QLV1 | 5-122 | ADVPALVASLGRYLGQEVTVVDLDVADDWFSCRVRSRAPSGTAFRTAWEGVLGMQRFAGEPDVSASLFLFSHGERVRLAGHRGSYLV… |
| B0C913 | 30-156 | None |
| A0A3A8G6W4 | 4-119 | None |
| A0A104N2L4 | 3-141 | None |
| A0A517ZMA5 | 9-150 | None |
| A0A239AKV1 | 7-99 | None |
| A0A090KHQ7 | 13-145 | None |
| A0A1L6M1U6 | 3-102 | None |
| A0A1H4XQY3 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.