DPCstruct | MC15521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 18.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0023- CL0172- CL0192- CL0533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4J506 | 2-98 | IRNAGIEPHVIEYLKTPPSRTLLIELIDRAGIMPRDLLREKGTPYAELGLGDSSLSDDALVDAMMAHPVLINRPLVVSPLGVKLCRP… |
| A0A496W246 | 28-140 | KNMQVIYNPKCSKCRTLEKELDTHGVSWEKLTYLETGISSERIAELFDQYEGDWRNLVREKESVFKEAGLNPKDMSRDEMMAFLVEH… |
| A0A0B7N3T3 | 1-124 | None |
| A0A1X7P8C3 | 152-268 | None |
| A0A164QNU8 | 288-412 | None |
| A0A349MLK0 | 3-118 | None |
| A0A139QZJ9 | 167-275 | None |
| A0A177WDX5 | 388-533 | None |
| V5BJN1 | 3-118 | None |
| A0A1E3H685 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.