DPCstruct | MC15520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1352 |
|---|---|
| Mean domain length (aa) | 180 ± 39 aa |
| Standard deviation of domain lengths | 38.79 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.03 |
| Pfam Score | 61.97 |
| Assigned Pfam label(s) | PF20464- PF20713- CL0236- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3G4I8 | 4-182 | INTPMLKTLWQDAQDYPEWAATKLWEYVFNRVIFRDDKWVVSSQQPPTRAADDKRRVDLVVQKQSSKGDLQTLLFLEAKRAEVDASV… |
| A0A496W116 | 11-174 | FKELIADNKPLIERYSEEDLKVNFIVPILNKIKFKSYDKKIRDFYELPMTYKTSQFILNGTCDFVVSEGLVESKKPYFFIQEFKRNE… |
| A0A4S2MN77 | 7-182 | None |
| C5F168 | 39-209 | None |
| A0A4S2MK28 | 8-142 | None |
| A0A4S2MHB7 | 96-283 | None |
| A0A3N4J5E9 | 406-593 | None |
| A0A3N4J0P6 | 270-462 | None |
| A0A3N4IW27 | 2-168 | None |
| A0A1S8VQZ5 | 109-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.