DPCstruct | MC1552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14242 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839HEI7 | 6-89 | DVRDASERVSLASGDLLGFIKQVIAQGNARRLIVRKADGSPLMDIPLTAGAVAGGAMTLFMPIITAIVAITALVKQVQVEIIRQ |
| A0A1Q8ATM2 | 14-95 | GLKKEVFQVSSEKLLEKFKELTRDATVKRVIIKDDQGKVVLSIPLTWGAAGAVATLALAPWLAALGVIAGIATKCTIEVQRV |
| D7CXJ8 | 38-128 | None |
| A0A136KVG9 | 8-95 | None |
| A0A2N6AC04 | 3-82 | None |
| A0A2D6J1H9 | 17-109 | None |
| A0A3A0BFH9 | 4-80 | None |
| E6SK86 | 47-132 | None |
| A0A800J3A6 | 28-108 | None |
| A0A1J5ITH0 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.