DPCstruct | MC15519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496VZ80 | 7-89 | VIDELPETLETVWLRIFGKGKTQQKAIETLATLEDQEPLLDNVLDVFHKWHEDTQAQDNLTPEDKELLMILSPAYEKSRTQAI |
| A0A6P0V138 | 201-276 | IDELPNSKETLWLRLLGRGKVRHQAILELVALPAHHSLRSVSLELFYNLLSSLEALPEKDDEDCLLIELLRSCQVE |
| S3IWW6 | 149-232 | None |
| A0A845YHM6 | 1-90 | None |
| I4G7I0 | 35-128 | None |
| A0A5P8WGB0 | 64-156 | None |
| A0A6P0VAC2 | 1-97 | None |
| A0A3B8JYP4 | 156-239 | None |
| A0A6M0BR96 | 6-94 | None |
| A0A496VPW9 | 139-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.