DPCstruct | MC15518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7LM63 | 2-129 | YFRAMTPHVDGLPMRGRSARTLGVRVPQDVNPDAAGYVNPGTGGLSVAPDSMWHVPNHRRPRGMGHGSTGPVQDHVFSIAPVALRDN… |
| A0A496VYB8 | 5-130 | EDLYIMGINEFNEDLFRMGNASSPSFSEARGLKDCLVVLIDGIQIVRANRNGFSAFNSITSVMKRKGKNVWKIKKGTTLEDIIIVKD… |
| G2QH92 | 11-156 | None |
| A0A7W5FFY6 | 3-116 | None |
| G4TJA8 | 16-121 | None |
| A0A3M9Y8J3 | 1-107 | None |
| A0A0G4N421 | 20-185 | None |
| M1WHM0 | 4-122 | None |
| E4ZG20 | 22-191 | None |
| A0A1R3R6A5 | 8-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.