DPCstruct | MC15514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4ECE1 | 10-195 | QEAIDANVSDALAKAYRYLKDLAGHLNAVHPAYSRGYGIAGVPEFGGLEWEEGEADFHMREISPAVKLYERVSLRFRLSGKKQIRVA… |
| A0A496VDG3 | 1-253 | MSYLEQLKNEAQVRQAQDRATELERQQQQAQREELFRTQVKPTLERLRHYLRELAEQLNYLKPDTRITYEIKGYGDIDDFQPQNYRV… |
| A0A080LXN7 | 88-297 | None |
| A0A496X4K9 | 4-211 | None |
| A0A6I7WFS0 | 4-179 | None |
| A0A1F4C8I7 | 302-510 | None |
| A0A661G9Z8 | 1-227 | None |
| A0A836X8S9 | 4-221 | None |
| A0A3B1AGA7 | 1-234 | None |
| A0A2W4T989 | 2-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.