DPCstruct | MC15511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 174 ± 23 aa |
| Standard deviation of domain lengths | 22.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6I7G0 | 6-139 | SACEYEVPITPSPTQKVQEPLLGDWTSTDGKEKMKVRKLDDSIYIVYYDGDLFRAYHSDIAETPFVSVQDLNSNDRKYAYVVWKLSD… |
| A0A7Y8LIQ3 | 11-174 | ALLMAGCETVSWLQPLYAPEDIVREESLAGSWRVDGEDTLTIAVEGDGYLLTIEDKKGGKTVYSAYLLRIGGELYADLTEKGGGIPD… |
| A0A4Q6FQT6 | 2-171 | None |
| A0A6J4F4M7 | 3-164 | None |
| A0A2M8BDR0 | 4-167 | None |
| A0A1G0WS37 | 14-201 | None |
| A0A7Y3U930 | 5-189 | None |
| A0A6N6P232 | 10-160 | None |
| A0A150XT58 | 158-290 | None |
| A0A2V8XRL2 | 7-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.